BTF3P13 anticorps (Middle Region)
-
- Antigène Tous les produits BTF3P13
- BTF3P13 (Basic Transcription Factor 3 Pseudogene 13 (BTF3P13))
- Épitope
- Middle Region
- Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp BTF3P13 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- BTF3 L3 antibody was raised against the middle region of BTF3 3
- Purification
- Affinity purified
- Immunogène
- BTF3 L3 antibody was raised using the middle region of BTF3 3 corresponding to a region with amino acids CRSTDHEPGKLAKLQAQVRIGGKGTAHRKKKVFHRTATADDKKLQFSLKK
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
BTF3L3 Blocking Peptide, catalog no. 33R-1800, is also available for use as a blocking control in assays to test for specificity of this BTF3L3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BTF0 3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- BTF3P13 (Basic Transcription Factor 3 Pseudogene 13 (BTF3P13))
- Autre désignation
- BTF3L3 (BTF3P13 Produits)
- Synonymes
- anticorps BTF3L3, anticorps HUMBTFD, anticorps basic transcription factor 3 pseudogene 13, anticorps BTF3P13
- Sujet
- BTF3L3 is a putative member of the BTF3 family of transcription factors and is thought to represent a pseudogene.
- Poids moléculaire
- 23 kDa (MW of target protein)
-