SNAP47 anticorps (Middle Region)

N° du produit ABIN632958

Détail du produit anti-SNAP47 anticorps

Antigène: SNAP47 (Synaptosomal-Associated Protein, 47kDa (SNAP47))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SNAP47 est non-conjugé

Application: Western Blotting (WB)

Specificité: C1 ORF142 antibody was raised against the middle region of C1 rf142

Purification: Affinity purified

Immunogène: C1 ORF142 antibody was raised using the middle region of C1 rf142 corresponding to a region with amino acids TALHLQTSLPALSEADTQELTQILRRMKGLALEAESELERQDEALDGVAA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C1ORF142 Blocking Peptide, catalog no. 33R-8979, is also available for use as a blocking control in assays to test for specificity of this C1ORF142 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF142 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SNAP47

Antigène: SNAP47 (Synaptosomal-Associated Protein, 47kDa (SNAP47))

Autre désignation: C1ORF142 (SNAP47 Produits)

Synonymes: anticorps 1110031B06Rik, anticorps SNAP-47, anticorps RGD735194, anticorps zgc:153222, anticorps C1orf142, anticorps HEL170, anticorps SVAP1, anticorps C7H1orf142, anticorps synaptosome associated protein 47, anticorps synaptosome associated protein 47kDa L homeolog, anticorps synaptosome associated protein 47kDa, anticorps synaptosomal-associated protein, 47, anticorps SNAP47, anticorps snap47.L, anticorps snap47, anticorps Snap47

Sujet: The C1ORF142 protein may play a role in intracellular membrane fusion.

Poids moléculaire: 51 kDa (MW of target protein)