CCDC74A anticorps (Middle Region)

N° du produit ABIN632959

Détail du produit anti-CCDC74A anticorps

Antigène: CCDC74A (Coiled-Coil Domain Containing 74A (CCDC74A))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CCDC74A est non-conjugé

Application: Western Blotting (WB)

Specificité: CCDC74 A antibody was raised against the middle region of CCDC74

Purification: Affinity purified

Immunogène: CCDC74 A antibody was raised using the middle region of CCDC74 corresponding to a region with amino acids FPKVSTKSLSKKCLSPPVAERAILPALKQTPKNNFAERQKRLQAMQKRRL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CCDC74A Blocking Peptide, catalog no. 33R-3020, is also available for use as a blocking control in assays to test for specificity of this CCDC74A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC70 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CCDC74A

Antigène: CCDC74A (Coiled-Coil Domain Containing 74A (CCDC74A))

Autre désignation: CCDC74A (CCDC74A Produits)

Synonymes: anticorps 2310015A05Rik, anticorps coiled-coil domain containing 74A, anticorps CCDC74A, anticorps Ccdc74a

Sujet: The function of CCDC74A protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 42 kDa (MW of target protein)