IPP anticorps (C-Term)

N° du produit ABIN632969

Détail du produit anti-IPP anticorps

Antigène: IPP (Intracisternal A Particle-Promoted Polypeptide (IPP))

Épitope: C-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IPP est non-conjugé

Application: Western Blotting (WB)

Specificité: IPP antibody was raised against the C terminal of IPP

Purification: Affinity purified

Immunogène: IPP antibody was raised using the C terminal of IPP corresponding to a region with amino acids EMQGLIYVIGGISNEGIELRSFEVYDPLSKRWSPLPPMGTRRAYLGVAAL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IPP Blocking Peptide, catalog no. 33R-2592, is also available for use as a blocking control in assays to test for specificity of this IPP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IPP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IPP

Antigène: IPP (Intracisternal A Particle-Promoted Polypeptide (IPP))

Autre désignation: IPP (IPP Produits)

Sujet: IPP is a member of the kelch family of proteins, which is characterized by a 50 amino acid repeat which interacts with actin.

Poids moléculaire: 65 kDa (MW of target protein)