Proline Rich 18 anticorps (N-Term)

N° du produit ABIN632970

Détail du produit anti-Proline Rich 18 anticorps

Antigène: Proline Rich 18 (PRR18)

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Proline Rich 18 est non-conjugé

Application: Western Blotting (WB)

Specificité: PRR18 antibody was raised against the N terminal of PRR18

Purification: Affinity purified

Immunogène: PRR18 antibody was raised using the N terminal of PRR18 corresponding to a region with amino acids RPPQRPEGLLSSSWPSATLKRPPARRGPGLDRTQPPAPPGVSPQALPSRA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PRR18 Blocking Peptide, catalog no. 33R-8101, is also available for use as a blocking control in assays to test for specificity of this PRR18 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRR18 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Proline Rich 18

Antigène: Proline Rich 18 (PRR18)

Autre désignation: PRR18 (PRR18 Produits)

Synonymes: anticorps 9630019K15Rik, anticorps proline rich 18, anticorps PRR18, anticorps Prr18

Sujet: The function of PRR18 has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 31 kDa (MW of target protein)