DIP2A anticorps
-
- Antigène Voir toutes DIP2A Anticorps
- DIP2A (DIP2 Disco-Interacting Protein 2 Homolog A (DIP2A))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DIP2A est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- DIP2 A antibody was raised using a synthetic peptide corresponding to a region with amino acids PLKEFFVDDFEELLEVQQPDPNQPKPEGSETSVLRGEPLTAGVPRPPSLL
- Top Product
- Discover our top product DIP2A Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DIP2A Blocking Peptide, catalog no. 33R-7196, is also available for use as a blocking control in assays to test for specificity of this DIP2A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DIP0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DIP2A (DIP2 Disco-Interacting Protein 2 Homolog A (DIP2A))
- Autre désignation
- DIP2A (DIP2A Produits)
- Synonymes
- anticorps C21orf106, anticorps Dip2-like, anticorps DIP2, anticorps 4931420H10Rik, anticorps AI426328, anticorps Dip2, anticorps Kiaa0184-hp, anticorps mKIAA0184, anticorps disco-interacting protein 2 homolog A, anticorps disco interacting protein 2 homolog A, anticorps Dip2a, anticorps DIP2A
- Sujet
- The protein encoded by this gene may be involved in axon patterning in the central nervous system. This gene is not highly expressed. Several transcript variants encoding different isoforms have been found for this gene.
- Poids moléculaire
- 170 kDa (MW of target protein)
- Pathways
- M Phase
-