RFESD anticorps

N° du produit ABIN632977

Détail du produit anti-RFESD anticorps

Antigène: RFESD (Rieske (Fe-S) Domain Containing (RFESD))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RFESD est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: RFESD antibody was raised using a synthetic peptide corresponding to a region with amino acids VVHDREVVIFYHKGEYHAMDIRCYHSGGPLHLGDIEDFDGRPCIVCPWHK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RFESD Blocking Peptide, catalog no. 33R-9881, is also available for use as a blocking control in assays to test for specificity of this RFESD antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RFESD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RFESD

Antigène: RFESD (Rieske (Fe-S) Domain Containing (RFESD))

Autre désignation: RFESD (RFESD Produits)

Synonymes: anticorps MGC82457, anticorps zgc:112118, anticorps AI256775, anticorps D030068K09, anticorps RGD1308284, anticorps Rieske Fe-S domain containing, anticorps Rieske (Fe-S) domain containing L homeolog, anticorps Rieske (Fe-S) domain containing, anticorps RFESD, anticorps rfesd.L, anticorps rfesd, anticorps Rfesd

Sujet: The function of RFESD protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 18 kDa (MW of target protein)