USP18 anticorps (N-Term)

N° du produit ABIN632980

Détail du produit anti-USP18 anticorps

Antigène: USP18 (Ubiquitin Specific Peptidase 18 (USP18))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp USP18 est non-conjugé

Application: Western Blotting (WB)

Specificité: USP18 antibody was raised against the N terminal of USP18

Purification: Affinity purified

Immunogène: USP18 antibody was raised using the N terminal of USP18 corresponding to a region with amino acids MQDSRQKAVRPLELAYCLQKCNVPLFVQHDAAQLYLKLWNLIKDQITDVH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

USP18 Blocking Peptide, catalog no. 33R-6322, is also available for use as a blocking control in assays to test for specificity of this USP18 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of USP18 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur USP18

Antigène: USP18 (Ubiquitin Specific Peptidase 18 (USP18))

Autre désignation: USP18 (USP18 Produits)

Synonymes: anticorps ISG43, anticorps UBP43, anticorps bubp43, anticorps 1110058H21Rik, anticorps AW047653, anticorps Ubp15, anticorps UBP, anticorps USP18, anticorps USP41, anticorps ubiquitin specific peptidase 18, anticorps USP18, anticorps Usp18

Sujet: USP18, a member of the deubiquitinating protease family of enzymes, removes ubiquitin adducts from a broad range of protein substrates.

Poids moléculaire: 43 kDa (MW of target protein)