USP18 anticorps (N-Term)
-
- Antigène Voir toutes USP18 Anticorps
- USP18 (Ubiquitin Specific Peptidase 18 (USP18))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp USP18 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- USP18 antibody was raised against the N terminal of USP18
- Purification
- Affinity purified
- Immunogène
- USP18 antibody was raised using the N terminal of USP18 corresponding to a region with amino acids MQDSRQKAVRPLELAYCLQKCNVPLFVQHDAAQLYLKLWNLIKDQITDVH
- Top Product
- Discover our top product USP18 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
USP18 Blocking Peptide, catalog no. 33R-6322, is also available for use as a blocking control in assays to test for specificity of this USP18 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of USP18 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- USP18 (Ubiquitin Specific Peptidase 18 (USP18))
- Autre désignation
- USP18 (USP18 Produits)
- Synonymes
- anticorps ISG43, anticorps UBP43, anticorps bubp43, anticorps 1110058H21Rik, anticorps AW047653, anticorps Ubp15, anticorps UBP, anticorps USP18, anticorps USP41, anticorps ubiquitin specific peptidase 18, anticorps USP18, anticorps Usp18
- Sujet
- USP18, a member of the deubiquitinating protease family of enzymes, removes ubiquitin adducts from a broad range of protein substrates.
- Poids moléculaire
- 43 kDa (MW of target protein)
-