C15orf26/CFAP161 anticorps (C-Term)

N° du produit ABIN632983

Détail du produit anti-C15orf26/CFAP161 anticorps

Antigène: C15orf26/CFAP161 (C15orf26) (Chromosome 15 Open Reading Frame 26 (C15orf26))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C15orf26/CFAP161 est non-conjugé

Application: Western Blotting (WB)

Specificité: C15 ORF26 antibody was raised against the C terminal Of C15 rf26

Purification: Affinity purified

Immunogène: C15 ORF26 antibody was raised using the C terminal Of C15 rf26 corresponding to a region with amino acids LINHCHTNRGLAAHRHLFLSTYFGKEAEVVAHTYLDSHRVEKPRNHWMLV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C15ORF26 Blocking Peptide, catalog no. 33R-5056, is also available for use as a blocking control in assays to test for specificity of this C15ORF26 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF26 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C15orf26/CFAP161

Antigène: C15orf26/CFAP161 (C15orf26) (Chromosome 15 Open Reading Frame 26 (C15orf26))

Autre désignation: C15ORF26 (C15orf26 Produits)

Synonymes: anticorps 1700026D08Rik, anticorps AW047638, anticorps AW551802, anticorps C21H15orf26, anticorps cilia and flagella associated protein 161, anticorps cilia and flagella associated protein 161 L homeolog, anticorps CFAP161, anticorps cfap161.L, anticorps cfap161, anticorps Cfap161

Sujet: The function of C15orf26 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 34 kDa (MW of target protein)