EIF3L anticorps (N-Term)
-
- Antigène Voir toutes EIF3L Anticorps
- EIF3L (Eukaryotic Translation Initiation Factor 3, Subunit L (EIF3L))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp EIF3L est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- EIF3 EIP antibody was raised against the N terminal of EIF3 IP
- Purification
- Affinity purified
- Immunogène
- EIF3 EIP antibody was raised using the N terminal of EIF3 IP corresponding to a region with amino acids SYPADDYESEAAYDPYAYPSDYDMHTGDPKQDLAYERQYEQQTYQVIPEV
- Top Product
- Discover our top product EIF3L Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
EIF3EIP Blocking Peptide, catalog no. 33R-8952, is also available for use as a blocking control in assays to test for specificity of this EIF3EIP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 IP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- EIF3L (Eukaryotic Translation Initiation Factor 3, Subunit L (EIF3L))
- Autre désignation
- EIF3EIP (EIF3L Produits)
- Synonymes
- anticorps wu:fb66c05, anticorps zgc:64147, anticorps EIF3EIP, anticorps EIF3S11, anticorps EIF3S6IP, anticorps HSPC021, anticorps HSPC025, anticorps MSTP005, anticorps 0610011H21Rik, anticorps D15N1e, anticorps Eif3eip, anticorps Eif3ip, anticorps Eif3s6ip, anticorps HSP-66Y, anticorps PAF67, anticorps eif3eip, anticorps eif3s6ip, anticorps eukaryotic translation initiation factor 3, subunit 6 interacting protein, anticorps eukaryotic translation initiation factor 3 subunit L, anticorps eukaryotic translation initiation factor 3, subunit L, anticorps eukaryotic translation initiation factor 3 subunit L L homeolog, anticorps eif3s6ip, anticorps EIF3L, anticorps Eif3l, anticorps eif3l.L
- Sujet
- EIF3EIP belongs to the EIF3EIP family. It interacts with EIF3E. EIF3EIP interacts with Int-6 and is associated with eukaryotic translation initiation factor 3.
- Poids moléculaire
- 67 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization
-