MAGEB3 anticorps (N-Term)

N° du produit ABIN633000

Détail du produit anti-MAGEB3 anticorps

Antigène: MAGEB3 (Melanoma Antigen Family B, 3 (MAGEB3))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MAGEB3 est non-conjugé

Application: Western Blotting (WB)

Specificité: MAGEB3 antibody was raised against the N terminal of MAGEB3

Purification: Affinity purified

Immunogène: MAGEB3 antibody was raised using the N terminal of MAGEB3 corresponding to a region with amino acids KKKVSFSSPLILGATIQKKSAGRSRSALKKPQRALSTTTSVDVSYKKSYK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MAGEB3 Blocking Peptide, catalog no. 33R-4479, is also available for use as a blocking control in assays to test for specificity of this MAGEB3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAGEB3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MAGEB3

Antigène: MAGEB3 (Melanoma Antigen Family B, 3 (MAGEB3))

Autre désignation: MAGEB3 (MAGEB3 Produits)

Synonymes: anticorps CT3.5, anticorps Smage3, anticorps Mage-b3, anticorps Mage-ps1, anticorps Mage-rs3, anticorps RGD1562343, anticorps MAGEB3, anticorps MAGE family member B3, anticorps melanoma antigen, family B, 3, anticorps melanoma-associated antigen B3, anticorps MAGE family member B5, anticorps MAGEB3, anticorps Mageb3, anticorps LOC509870, anticorps MAGEB5

Sujet: This gene is a MAGE-B subfamily member of the MAGE gene family. MAGE family member proteins direct the expression of tumor antigens recognised on a human melanoma by autologous cytolytic T lymphocytes. There are two known clusters of MAGE genes on chromos

Poids moléculaire: 39 kDa (MW of target protein)