PRPS2 anticorps (N-Term)
-
- Antigène Voir toutes PRPS2 Anticorps
- PRPS2 (phosphoribosyl Pyrophosphate Synthetase 2 (PRPS2))
-
Épitope
- N-Term
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PRPS2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PRPS2 antibody was raised against the N terminal of PRPS2
- Purification
- Affinity purified
- Immunogène
- PRPS2 antibody was raised using the N terminal of PRPS2 corresponding to a region with amino acids PNIVLFSGSSHQDLSQRVADRLGLELGKVVTKKFSNQETSVEIGESVRGE
- Top Product
- Discover our top product PRPS2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PRPS2 Blocking Peptide, catalog no. 33R-7234, is also available for use as a blocking control in assays to test for specificity of this PRPS2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRPS2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PRPS2 (phosphoribosyl Pyrophosphate Synthetase 2 (PRPS2))
- Autre désignation
- PRPS2 (PRPS2 Produits)
- Synonymes
- anticorps prsii, anticorps PRSII, anticorps 2610101M19Rik, anticorps AA589463, anticorps AI464149, anticorps Prps-2, anticorps phosphoribosyl pyrophosphate synthetase 2 L homeolog, anticorps phosphoribosyl pyrophosphate synthetase 2, anticorps prps2.L, anticorps PRPS2, anticorps Prps2
- Sujet
- PRPS2 is a phosphoribosyl pyrophosphate synthetase that plays a central role in the synthesis of purines and pyrimidines. The encoded protein catalyzes the synthesis of 5-phosphoribosyl 1-pyrophosphate from ATP and D-ribose 5-phosphate.
- Poids moléculaire
- 35 kDa (MW of target protein)
- Pathways
- Ribonucleoside Biosynthetic Process
-