SFRS12 anticorps (N-Term)

N° du produit ABIN633011

Détail du produit anti-SFRS12 anticorps

Antigène: SFRS12 (SREK1) (Splicing Regulatory Glutamine/lysine-Rich Protein 1 (SREK1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SFRS12 est non-conjugé

Application: Western Blotting (WB)

Specificité: SFRS12 antibody was raised against the N terminal of SFRS12

Purification: Affinity purified

Immunogène: SFRS12 antibody was raised using the N terminal of SFRS12 corresponding to a region with amino acids DPSSVGVAQHLTNTVFIDRALIVVPCAEGKIPEESKALSLLAPAPTMTSL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SFRS12 Blocking Peptide, catalog no. 33R-2117, is also available for use as a blocking control in assays to test for specificity of this SFRS12 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SFRS12

Antigène: SFRS12 (SREK1) (Splicing Regulatory Glutamine/lysine-Rich Protein 1 (SREK1))

Autre désignation: SFRS12 (SREK1 Produits)

Synonymes: anticorps SFRS12, anticorps SRrp508, anticorps SRrp86, anticorps Sfrs12, anticorps Srrp86, anticorps Srsf12, anticorps 8430401B01, anticorps AI450757, anticorps AI462342, anticorps zgc:100974, anticorps splicing regulatory glutamic acid and lysine rich protein 1, anticorps splicing regulatory glutamine/lysine-rich protein 1, anticorps SREK1, anticorps Srek1, anticorps srek1

Sujet: SFRS12 belongs to the superfamily of serine/arginine-rich (SR) splicing factors. It modulates splice site selection by regulating the activities of other SR proteins.

Poids moléculaire: 72 kDa (MW of target protein)