IQCD anticorps (N-Term)
-
- Antigène Voir toutes IQCD Anticorps
- IQCD (IQ Motif Containing D (IQCD))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp IQCD est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- IQCD antibody was raised against the N terminal of IQCD
- Purification
- Affinity purified
- Immunogène
- IQCD antibody was raised using the N terminal of IQCD corresponding to a region with amino acids ALDILAMAPLYQAPAINRIGPKTDPSKRPADPLKPLVLSRTKLTTIEAKR
- Top Product
- Discover our top product IQCD Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
IQCD Blocking Peptide, catalog no. 33R-1322, is also available for use as a blocking control in assays to test for specificity of this IQCD antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IQCD antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- IQCD (IQ Motif Containing D (IQCD))
- Autre désignation
- IQCD (IQCD Produits)
- Synonymes
- anticorps 4933433C09Rik, anticorps AI662646, anticorps IQ motif containing D, anticorps IQCD, anticorps Iqcd
- Sujet
- IQCD contains 1 IQ domain. The function of the IQCD protein is not known.
- Poids moléculaire
- 40 kDa (MW of target protein)
-