IQCD anticorps (N-Term)

N° du produit ABIN633012

Détail du produit anti-IQCD anticorps

Antigène: IQCD (IQ Motif Containing D (IQCD))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IQCD est non-conjugé

Application: Western Blotting (WB)

Specificité: IQCD antibody was raised against the N terminal of IQCD

Purification: Affinity purified

Immunogène: IQCD antibody was raised using the N terminal of IQCD corresponding to a region with amino acids ALDILAMAPLYQAPAINRIGPKTDPSKRPADPLKPLVLSRTKLTTIEAKR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IQCD Blocking Peptide, catalog no. 33R-1322, is also available for use as a blocking control in assays to test for specificity of this IQCD antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IQCD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IQCD

Antigène: IQCD (IQ Motif Containing D (IQCD))

Autre désignation: IQCD (IQCD Produits)

Sujet: IQCD contains 1 IQ domain. The function of the IQCD protein is not known.

Poids moléculaire: 40 kDa (MW of target protein)