C6orf154 anticorps (Middle Region)

N° du produit ABIN633015

Détail du produit anti-C6orf154 anticorps

Antigène: C6orf154 (Chromosome 6 Open Reading Frame 154 (C6orf154))

Épitope: Middle Region

Reactivité: Rat, Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C6orf154 est non-conjugé

Application: Western Blotting (WB)

Specificité: C6 ORF154 antibody was raised against the middle region of C6 rf154

Purification: Affinity purified

Immunogène: C6 ORF154 antibody was raised using the middle region of C6 rf154 corresponding to a region with amino acids NLDYNPLGDHVAGMLAVAVASSRTLEVLDLEGTGLTNQSAQTLLDMVENY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C6ORF154 Blocking Peptide, catalog no. 33R-6754, is also available for use as a blocking control in assays to test for specificity of this C6ORF154 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF154 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C6orf154

Antigène: C6orf154 (Chromosome 6 Open Reading Frame 154 (C6orf154))

Autre désignation: C6ORF154 (C6orf154 Produits)

Synonymes: anticorps C6orf154, anticorps LRRC73, anticorps nod3l, anticorps leucine rich repeat containing 73, anticorps LRRC73, anticorps Lrrc73

Sujet: The function of Chromosome 6 ORF protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 33 kDa (MW of target protein)