FAM78A anticorps (N-Term)

N° du produit ABIN633017

Détail du produit anti-FAM78A anticorps

Antigène: FAM78A (Family with Sequence Similarity 78, Member A (FAM78A))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAM78A est non-conjugé

Application: Western Blotting (WB)

Specificité: FAM78 A antibody was raised against the N terminal of FAM78

Purification: Affinity purified

Immunogène: FAM78 A antibody was raised using the N terminal of FAM78 corresponding to a region with amino acids MPGFFCDCWPSLEIRALLYAMGCIQSIGGKARVFREGITVIDVKASIDPV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM78A Blocking Peptide, catalog no. 33R-6279, is also available for use as a blocking control in assays to test for specificity of this FAM78A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM70 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAM78A

Antigène: FAM78A (Family with Sequence Similarity 78, Member A (FAM78A))

Autre désignation: FAM78A (FAM78A Produits)

Synonymes: anticorps fam78a, anticorps zgc:175187, anticorps C9orf59, anticorps A130092J06Rik, anticorps RGD1566351, anticorps family with sequence similarity 78 member A, anticorps family with sequence similarity 78, member Ab, anticorps family with sequence similarity 78, member A, anticorps FAM78A, anticorps fam78ab, anticorps fam78a, anticorps Fam78a

Sujet: The function of FAM78A has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 32 kDa (MW of target protein)