Phosphoglucomutase 3 anticorps (N-Term)

N° du produit ABIN633023

Détail du produit anti-Phosphoglucomutase 3 anticorps

Antigène: Phosphoglucomutase 3 (PGM3)

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Phosphoglucomutase 3 est non-conjugé

Application: Western Blotting (WB)

Specificité: PGM3 antibody was raised against the N terminal of PGM3

Purification: Affinity purified

Immunogène: PGM3 antibody was raised using the N terminal of PGM3 corresponding to a region with amino acids IDISEKEAVNLQQDAFVVIGRDTRPSSEKLSQSVIDGVTVLGGQFHDYGL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PGM3 Blocking Peptide, catalog no. 33R-3917, is also available for use as a blocking control in assays to test for specificity of this PGM3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGM3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Phosphoglucomutase 3

Antigène: Phosphoglucomutase 3 (PGM3)

Autre désignation: PGM3 (PGM3 Produits)

Synonymes: anticorps pgm3, anticorps MGC69105, anticorps wu:fc08c11, anticorps wu:fc39c03, anticorps zgc:91932, anticorps PGM3, anticorps AGM1, anticorps PAGM, anticorps PGM 3, anticorps 2810473H05Rik, anticorps Agm1, anticorps BB187688, anticorps C77933, anticorps Pgm-3, anticorps phosphoglucomutase 3 L homeolog, anticorps phosphoglucomutase 3, anticorps phosphoacetylglucosamine mutase, anticorps pgm3.L, anticorps PGM3, anticorps pgm3, anticorps PGTG_05011, anticorps Pgm3

Sujet: PGM3 interconverts GlcNAc-6-P and GlcNAc-1-P.

Poids moléculaire: 60 kDa (MW of target protein)