CA5B anticorps (N-Term)

N° du produit ABIN633032

Détail du produit anti-CA5B anticorps

Antigène: CA5B (Carbonic Anhydrase VB, Mitochondrial (CA5B))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CA5B est non-conjugé

Application: Western Blotting (WB)

Specificité: Carbonic Anhydrase Vb antibody (Mitochondrial) was raised against the N terminal of CA5 B

Purification: Affinity purified

Immunogène: Carbonic Anhydrase Vb antibody (Mitochondrial) was raised using the N terminal of CA5 B corresponding to a region with amino acids WRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Carbonic Anhydrase Vb Blocking Peptide (Mitochondrial), catalog no. 33R-9998, is also available for use as a blocking control in assays to test for specificity of this Carbonic Anhydrase Vb antibody (Mitochondrial)

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CA0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CA5B

Antigène: CA5B (Carbonic Anhydrase VB, Mitochondrial (CA5B))

Autre désignation: Carbonic Anhydrase Vb (CA5B Produits)

Synonymes: anticorps CA-VB, anticorps 7330410H16Rik, anticorps CAVB, anticorps Ca5b, anticorps CarVb, anticorps D730005F19Rik, anticorps zgc:171653, anticorps CA5B, anticorps ca5b, anticorps carbonic anhydrase 5B, anticorps carbonic anhydrase 5b, mitochondrial, anticorps carbonic anhydrase Va, anticorps carbonic anhydrase 5A, anticorps carbonic anhydrase 5B, mitochondrial, anticorps carbonic anhydrase VB, mitochondrial L homeolog, anticorps CA5B, anticorps Car5b, anticorps Ca5b, anticorps ca5a, anticorps CA5A, anticorps LOC100051095, anticorps ca5b.L

Sujet: Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA VB is localized in the mitochondria and shows the highest sequence similarity to the other mitochondrial CA, CA VA. It has a wider tissue distribution than CA VA, which is restricted to the liver. The differences in tissue distribution suggest that the two mitochondrial carbonic anhydrases evolved to assume different physiologic roles.

Poids moléculaire: 33 kDa (MW of target protein)