UTP14A anticorps
-
- Antigène Voir toutes UTP14A Anticorps
- UTP14A (UTP14, U3 Small Nucleolar Ribonucleoprotein, Homolog A (UTP14A))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp UTP14A est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- UTP14 A antibody was raised using a synthetic peptide corresponding to a region with amino acids KWDPVVLKNRQAEQLVFPLEKEEPAIAPIEHVLSGWKARTPLEQEIFNLL
- Top Product
- Discover our top product UTP14A Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
UTP14A Blocking Peptide, catalog no. 33R-4729, is also available for use as a blocking control in assays to test for specificity of this UTP14A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UTP10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- UTP14A (UTP14, U3 Small Nucleolar Ribonucleoprotein, Homolog A (UTP14A))
- Autre désignation
- UTP14A (UTP14A Produits)
- Synonymes
- anticorps NYCO16, anticorps SDCCAG16, anticorps dJ537K23.3, anticorps 2700066J21Rik, anticorps JsdX, anticorps NY-CO-16, anticorps T25628, anticorps mKIAA0266, anticorps UTP14C, anticorps UTP14A, anticorps utp14a, anticorps UTP14A, small subunit processome component, anticorps UTP14A small subunit processome component, anticorps UTP14, U3 small nucleolar ribonucleoprotein, homolog A-like, anticorps U3 small nucleolar RNA-associated protein 14 homolog A, anticorps UTP14A, small subunit processome component L homeolog, anticorps UTP14A, anticorps Utp14a, anticorps LOC505600, anticorps LOC100083222, anticorps utp14a.L
- Sujet
- This gene encodes a member of the uridine triphosphate 14 family. As an essential component of a large ribonucleoprotein complex bound to the U3 small nucleolar RNA, the encoded protein is involved in ribosome biogenesis and 18S rRNA synthesis. An autosomal retrotransposed copy of this X-linked gene exists on chromosome 13. Alternative splicing results in multiple transcript variants.
- Poids moléculaire
- 88 kDa (MW of target protein)
-