SULT1E1 anticorps (Middle Region)
-
- Antigène Voir toutes SULT1E1 Anticorps
- SULT1E1 (Sulfotransferase Family 1E Member 1 (SULT1E1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SULT1E1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SULT1 E1 antibody was raised against the middle region of SULT1 1
- Purification
- Affinity purified
- Immunogène
- SULT1 E1 antibody was raised using the middle region of SULT1 1 corresponding to a region with amino acids LMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFY
- Top Product
- Discover our top product SULT1E1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SULT1E1 Blocking Peptide, catalog no. 33R-5214, is also available for use as a blocking control in assays to test for specificity of this SULT1E1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SULT0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SULT1E1 (Sulfotransferase Family 1E Member 1 (SULT1E1))
- Autre désignation
- SULT1E1 (SULT1E1 Produits)
- Synonymes
- anticorps STE, anticorps St1, anticorps EST, anticorps ST1E1, anticorps Ste, anticorps EST-1, anticorps est-1, anticorps ste, anticorps sult1e1, anticorps sult1e1.S, anticorps sulfotransferase family 1E member 1, anticorps sulfotransferase family 1E, estrogen-preferring, member 1, anticorps estrogen sulfotransferase, anticorps sulfotransferase family 1E, member 1, anticorps sulfotransferase family 1E member 1 L homeolog, anticorps Sult1e1, anticorps SULT1E1, anticorps St1, anticorps CpipJ_CPIJ012993, anticorps CpipJ_CPIJ014515, anticorps LOC482182, anticorps sult1e1.L
- Sujet
- Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a protein that transfers a sulfo moiety to and from estrone, which may control levels of estrogen receptors.
- Poids moléculaire
- 35 kDa (MW of target protein)
- Pathways
- Steroid Hormone Biosynthesis
-