PNKP anticorps (N-Term)

N° du produit ABIN633050

Détail du produit anti-PNKP anticorps

Antigène: PNKP (Polynucleotide Kinase 3'-Phosphatase (PNKP))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PNKP est non-conjugé

Application: Western Blotting (WB)

Specificité: PNKP antibody was raised against the N terminal of PNKP

Purification: Affinity purified

Immunogène: PNKP antibody was raised using the N terminal of PNKP corresponding to a region with amino acids MGEVEAPGRLWLESPPGGAPPIFLPSDGQALVLGRGPLTQVTDRKCSRTQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PNKP Blocking Peptide, catalog no. 33R-6026, is also available for use as a blocking control in assays to test for specificity of this PNKP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNKP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PNKP

Antigène: PNKP (Polynucleotide Kinase 3'-Phosphatase (PNKP))

Autre désignation: PNKP (PNKP Produits)

Synonymes: anticorps EIEE10, anticorps MCSZ, anticorps PNK, anticorps Tb06.28P18.320, anticorps 21.m03011, anticorps 1810009G08Rik, anticorps polynucleotide kinase 3'-phosphatase, anticorps hypothetical protein, anticorps polynucleotide kinase 3'- phosphatase, anticorps PNKP, anticorps Pnkp, anticorps Tc00.1047053507017.50, anticorps Tc00.1047053505807.190, anticorps Tb927.6.1580, anticorps BBOV_IV000690, anticorps CC1G_05202, anticorps PGTG_20262, anticorps PGTG_18987, anticorps pnkp.S, anticorps pnkp

Sujet: This locus represents a gene involved in DNA repair. In response to ionizing radiation or oxidative damage, the protein encoded by this locus catalyzes 5' phosphorylation and 3' dephosphorylation of nucleic acids. Mutations at this locus have been associated with microcephaly, seizures, and developmental delay.

Poids moléculaire: 57 kDa (MW of target protein)

Pathways: Réparation de l'ADN, Nucleotide Phosphorylation