UGGT1 anticorps (Middle Region)
-
- Antigène Voir toutes UGGT1 Anticorps
- UGGT1 (UDP-Glucose Glycoprotein Glucosyltransferase 1 (UGGT1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp UGGT1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- UGCGL1 antibody was raised against the middle region of µgCGL1
- Purification
- Affinity purified
- Immunogène
- UGCGL1 antibody was raised using the middle region of µgCGL1 corresponding to a region with amino acids AAVRIVPEWQDYDQEIKQLQIRFQKEKETGALYKEKTKEPSREGPQKREE
- Top Product
- Discover our top product UGGT1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
UGCGL1 Blocking Peptide, catalog no. 33R-1061, is also available for use as a blocking control in assays to test for specificity of this µgCGL1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgCGL1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- UGGT1 (UDP-Glucose Glycoprotein Glucosyltransferase 1 (UGGT1))
- Autre désignation
- UGCGL1 (UGGT1 Produits)
- Synonymes
- anticorps UGCGL1, anticorps ugcgl1, anticorps uggt2, anticorps 0910001L17Rik, anticorps A930007H10Rik, anticorps AA589501, anticorps AI414429, anticorps AI448372, anticorps C820010P03Rik, anticorps GT, anticorps UGT1, anticorps Ugcgl1, anticorps Uggt, anticorps rUGT1, anticorps HUGT1, anticorps EMS-mutagenized bri1 suppressor 1, anticorps F3I17.13, anticorps F3I17_13, anticorps PRIORITY IN SWEET LIFE 2, anticorps PSL2, anticorps UDP-GLUCOSE:GLYCOPROTEIN GLUCOSYLTRANSFERASE, anticorps UGGT, anticorps UDP-glucose glycoprotein glucosyltransferase 1, anticorps UDP-glucose glycoprotein glucosyltransferase 1 L homeolog, anticorps UDP-glucose:glycoprotein glucosyltransferase 1, anticorps EMS-MUTAGENIZED BRI1 SUPPRESSOR 1, anticorps UGGT1, anticorps uggt1.L, anticorps uggt1, anticorps LOC100545947, anticorps Uggt1, anticorps EBS1
- Sujet
- UDP-glucose:glycoprotein glucosyltransferase (UGT) is a soluble protein of the endoplasmic reticulum (ER) that selectively reglucosylates unfolded glycoproteins, thus providing quality control for protein transport out of the ER.
- Poids moléculaire
- 175 kDa (MW of target protein)
- Pathways
- Activation of Innate immune Response
-