EXOC8 anticorps (N-Term)

N° du produit ABIN633065

Détail du produit anti-EXOC8 anticorps

Antigène: EXOC8 (EXO84) (Exocyst Complex Component 8 (EXO84))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EXOC8 est non-conjugé

Application: Western Blotting (WB)

Specificité: EXOC8 antibody was raised against the N terminal of EXOC8

Purification: Affinity purified

Immunogène: EXOC8 antibody was raised using the N terminal of EXOC8 corresponding to a region with amino acids MAMAMSDSGASRLRRQLESGGFEARLYVKQLSQQSDGDRDLQEHRQRIQA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EXOC8 Blocking Peptide, catalog no. 33R-5702, is also available for use as a blocking control in assays to test for specificity of this EXOC8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOC8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EXOC8

Antigène: EXOC8 (EXO84) (Exocyst Complex Component 8 (EXO84))

Autre désignation: EXOC8 (EXO84 Produits)

Synonymes: anticorps EXOC8, anticorps zgc:162287, anticorps EXO84, anticorps Exo84p, anticorps SEC84, anticorps AI414418, anticorps R74783, anticorps Exo84, anticorps exocyst complex component 8, anticorps exocyst complex component 8 S homeolog, anticorps EXOC8, anticorps exoc8, anticorps Tsp_09714, anticorps Exoc8, anticorps exoc8.S

Sujet: EXOC8 is the component of the exocyst complex involved in the docking of exocystic vesicles with fusion sites on the plasma membrane.

Poids moléculaire: 82 kDa (MW of target protein)

Pathways: Peptide Hormone Metabolism