DYNC1I2 anticorps (N-Term)

N° du produit ABIN633070

Détail du produit anti-DYNC1I2 anticorps

Antigène: DYNC1I2 (Dynein, Cytoplasmic 1, Intermediate Chain 2 (DYNC1I2))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DYNC1I2 est non-conjugé

Application: Western Blotting (WB)

Specificité: DYNC1 I2 antibody was raised against the N terminal of DYNC1 2

Purification: Affinity purified

Immunogène: DYNC1 I2 antibody was raised using the N terminal of DYNC1 2 corresponding to a region with amino acids VAPKPPIEPEEEKTLKKDEENDSKAPPHELTEEEKQQILHSEEFLSFFDH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DYNC1I2 Blocking Peptide, catalog no. 33R-9431, is also available for use as a blocking control in assays to test for specificity of this DYNC1I2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DYNC0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DYNC1I2

Antigène: DYNC1I2 (Dynein, Cytoplasmic 1, Intermediate Chain 2 (DYNC1I2))

Autre désignation: DYNC1I2 (DYNC1I2 Produits)

Synonymes: anticorps dnci2, anticorps dncic1, anticorps ic2, anticorps dync1i2, anticorps im:7147021, anticorps zgc:153318, anticorps 3110079H08Rik, anticorps AW554389, anticorps Dncic2, anticorps Dnci2, anticorps DNCI2, anticorps IC2, anticorps dynein, cytoplasmic 1, intermediate chain 2, anticorps dynein, cytoplasmic 1, intermediate chain 2 S homeolog, anticorps dynein cytoplasmic 1 intermediate chain 2, anticorps dynein, cytoplasmic 1, intermediate chain 2a, anticorps dync1i2, anticorps dync1i2.S, anticorps DYNC1I2, anticorps dync1i2a, anticorps Dync1i2

Sujet: DYNC1I2 acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. The intermediate chains mediate the binding of dynein to dynactin via its 150 kDa component (p150-glued) DCNT1. Involved in membrane-transport, such as Golgi apparatus, late endosomes and lysosomes.

Poids moléculaire: 71 kDa (MW of target protein)

Pathways: M Phase