RAB39 anticorps (N-Term)
-
- Antigène Voir toutes RAB39 Anticorps
- RAB39 (RAB39, Member RAS Oncogene Family (RAB39))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RAB39 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RAB39 antibody was raised against the N terminal of RAB39
- Purification
- Affinity purified
- Immunogène
- RAB39 antibody was raised using the N terminal of RAB39 corresponding to a region with amino acids METIWIYQFRLIVIGDSTVGKSCLLHRFTQGRFPGLRSPACDPTVGVDFF
- Top Product
- Discover our top product RAB39 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RAB39 Blocking Peptide, catalog no. 33R-5969, is also available for use as a blocking control in assays to test for specificity of this RAB39 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB39 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RAB39 (RAB39, Member RAS Oncogene Family (RAB39))
- Autre désignation
- RAB39 (RAB39 Produits)
- Synonymes
- anticorps C230094F14Rik, anticorps Rab39a, anticorps RAB39, member RAS oncogene family, anticorps Rab39
- Sujet
- RAB39 may be involved in vesicular trafficking.
- Poids moléculaire
- 25 kDa (MW of target protein)
-