CPLX2 anticorps (N-Term)

N° du produit ABIN633073

Détail du produit anti-CPLX2 anticorps

Antigène: CPLX2 (Complexin 2 (CPLX2))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CPLX2 est non-conjugé

Application: Western Blotting (WB)

Specificité: Complexin 2 antibody was raised against the N terminal of CPLX2

Purification: Affinity purified

Immunogène: Complexin 2 antibody was raised using the N terminal of CPLX2 corresponding to a region with amino acids MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Complexin 2 Blocking Peptide, catalog no. 33R-5832, is also available for use as a blocking control in assays to test for specificity of this Complexin 2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPLX2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CPLX2

Antigène: CPLX2 (Complexin 2 (CPLX2))

Autre désignation: Complexin 2 (CPLX2 Produits)

Synonymes: anticorps 921-L, anticorps CPX-2, anticorps CPX2, anticorps Hfb1, anticorps AI413745, anticorps AW492120, anticorps MGC68923, anticorps MGC79539, anticorps complexin 2, anticorps complexin 2 L homeolog, anticorps complexin-2, anticorps CPLX2, anticorps Cplx2, anticorps cplx2.L, anticorps cplx2, anticorps LOC750228

Sujet: Proteins encoded by the complexin/synaphin gene family are cytosolic proteins that function in synaptic vesicle exocytosis. These proteins bind syntaxin, part of the SNAP receptor. The protein product of this gene binds to the SNAP receptor complex and disrupts it, allowing transmitter release. Two transcript variants encoding the same protein have been found for this gene.

Poids moléculaire: 15 kDa (MW of target protein)

Pathways: Synaptic Vesicle Exocytosis