RABEPK anticorps (N-Term)

N° du produit ABIN633075

Détail du produit anti-RABEPK anticorps

Antigène: RABEPK (Rab9 Effector Protein with Kelch Motifs (RABEPK))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RABEPK est non-conjugé

Application: Western Blotting (WB)

Specificité: RABEPK antibody was raised against the N terminal of RABEPK

Purification: Affinity purified

Immunogène: RABEPK antibody was raised using the N terminal of RABEPK corresponding to a region with amino acids MKQLPVLEPGDKPRKATWYTLTVPGDSPCARVGHSCSYLPPVGNAKRGKV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RABEPK Blocking Peptide, catalog no. 33R-6159, is also available for use as a blocking control in assays to test for specificity of this RABEPK antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RABEPK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RABEPK

Antigène: RABEPK (Rab9 Effector Protein with Kelch Motifs (RABEPK))

Autre désignation: RABEPK (RABEPK Produits)

Sujet: RABEPK is a rab9 effector required for endosome to trans-Golgi network (TGN) transport.

Poids moléculaire: 40 kDa (MW of target protein)