TUBB4 anticorps (N-Term)

N° du produit ABIN633077

Détail du produit anti-TUBB4 anticorps

Antigène: TUBB4 (TUBB4A) (Tubulin beta 4a (TUBB4A))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TUBB4 est non-conjugé

Application: Western Blotting (WB)

Specificité: Beta Tubulin 4 antibody was raised against the N terminal of TUBB4

Purification: Affinity purified

Immunogène: Beta Tubulin 4 antibody was raised using the N terminal of TUBB4 corresponding to a region with amino acids TYHGDSDLQLERINVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Beta Tubulin 4 Blocking Peptide, catalog no. 33R-9390, is also available for use as a blocking control in assays to test for specificity of this Beta Tubulin 4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TUBB4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TUBB4

Antigène: TUBB4 (TUBB4A) (Tubulin beta 4a (TUBB4A))

Abstract: TUBB4A Produits

Synonymes: anticorps DYT4, anticorps HLD6, anticorps TUBB4, anticorps TUBB5, anticorps beta-5, anticorps AI325297, anticorps M(beta)4, anticorps Tubb, anticorps Tubb4, anticorps betatub56d, anticorps tubb2, anticorps tubb2c, anticorps tubb4, anticorps tubb4a, anticorps tubb5, anticorps tubulin beta 4A class IVa, anticorps tubulin, beta 4A class IVA, anticorps tubulin, beta 4A class IVa, anticorps tubulin beta 4B class IVb L homeolog, anticorps Tubulin beta-4A chain, anticorps tubulin beta 4A class IVa S homeolog, anticorps TUBB4A, anticorps Tubb4a, anticorps tubb4b.L, anticorps tubb4a.S

Sujet: Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain.

Poids moléculaire: 49 kDa (MW of target protein)