WIPF2 anticorps (Middle Region)

N° du produit ABIN633078

Détail du produit anti-WIPF2 anticorps

Antigène: WIPF2 (WAS/WASL Interacting Protein Family, Member 2 (WIPF2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp WIPF2 est non-conjugé

Application: Western Blotting (WB)

Specificité: WIPF2 antibody was raised against the middle region of WIPF2

Purification: Affinity purified

Immunogène: WIPF2 antibody was raised using the middle region of WIPF2 corresponding to a region with amino acids AAPPPPPPVIRNGARDAPPPPPPYRMHGSEPPSRGKPPPPPSRTPAGPPP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

WIPF2 Blocking Peptide, catalog no. 33R-1041, is also available for use as a blocking control in assays to test for specificity of this WIPF2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WIPF2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur WIPF2

Antigène: WIPF2 (WAS/WASL Interacting Protein Family, Member 2 (WIPF2))

Autre désignation: WIPF2 (WIPF2 Produits)

Synonymes: anticorps wich, anticorps wire, anticorps MGC86383, anticorps wip/cr16, anticorps WICH, anticorps WIRE, anticorps 1110014J05Rik, anticorps 5730509C05Rik, anticorps AA407487, anticorps Gm1176, anticorps Wich, anticorps Wire, anticorps RGD1561080, anticorps WAS/WASL interacting protein family member 2, anticorps WAS/WASL interacting protein family member 2 S homeolog, anticorps WAS/WASL interacting protein family, member 2, anticorps WIPF2, anticorps wipf2.S, anticorps Wipf2

Sujet: This gene encodes a WASP interacting protein (WIP)-related protein. It has been shown that this protein has a role in the WASP-mediated organization of the actin cytoskeleton and that this protein is a potential link between the activated platelet-derived growth factor receptor and the actin polymerization machinery.

Poids moléculaire: 46 kDa (MW of target protein)