LRG1 anticorps (N-Term)
-
- Antigène Voir toutes LRG1 Anticorps
- LRG1 (Leucine-Rich alpha-2 Glycoprotein 1 (LRG1))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LRG1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- LRG1 antibody was raised against the N terminal of LRG1
- Purification
- Affinity purified
- Immunogène
- LRG1 antibody was raised using the N terminal of LRG1 corresponding to a region with amino acids GVTLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLP
- Top Product
- Discover our top product LRG1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
LRG1 Blocking Peptide, catalog no. 33R-3657, is also available for use as a blocking control in assays to test for specificity of this LRG1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRG1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- LRG1 (Leucine-Rich alpha-2 Glycoprotein 1 (LRG1))
- Autre désignation
- LRG1 (LRG1 Produits)
- Synonymes
- anticorps lrg, anticorps HMFT1766, anticorps LRG, anticorps 1300008B03Rik, anticorps 2310031E04Rik, anticorps Lrg, anticorps Lrhg, anticorps si:dkey-90m5.4, anticorps leucine rich alpha-2-glycoprotein 1, anticorps leucine-rich alpha-2-glycoprotein 1 L homeolog, anticorps leucine-rich alpha-2-glycoprotein 1, anticorps perilipin-5, anticorps si:dkey-90m5.4, anticorps LRG1, anticorps lrg1.L, anticorps Lrg1, anticorps PLIN5
- Sujet
- The leucine-rich repeat (LRR) family of proteins, including LRG1, have been shown to be involved in protein-protein interaction, signal transduction, and cell adhesion and development. LRG1 is expressed during granulocyte differentiation.
- Poids moléculaire
- 38 kDa (MW of target protein)
- Pathways
- Brown Fat Cell Differentiation
-