ATP6AP1 anticorps (Middle Region)
-
- Antigène Voir toutes ATP6AP1 Anticorps
- ATP6AP1 (ATPase, H+ Transporting, Lysosomal Accessory Protein 1 (ATP6AP1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ATP6AP1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ATP6 AP1 antibody was raised against the middle region of ATP6 P1
- Purification
- Affinity purified
- Immunogène
- ATP6 AP1 antibody was raised using the middle region of ATP6 P1 corresponding to a region with amino acids SPVIHPPVSYNDTAPRILFWAQNFSVAYKDQWEDLTPLTFGVQELNLTGS
- Top Product
- Discover our top product ATP6AP1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ATP6AP1 Blocking Peptide, catalog no. 33R-8700, is also available for use as a blocking control in assays to test for specificity of this ATP6AP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 P1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ATP6AP1 (ATPase, H+ Transporting, Lysosomal Accessory Protein 1 (ATP6AP1))
- Autre désignation
- ATP6AP1 (ATP6AP1 Produits)
- Synonymes
- anticorps 16A, anticorps ATP6IP1, anticorps ATP6S1, anticorps Ac45, anticorps CF2, anticorps VATPS1, anticorps XAP-3, anticorps XAP3, anticorps AC45, anticorps AI316502, anticorps AW108110, anticorps Atp6ip1, anticorps Atp6s1, anticorps C7-1, anticorps mFLJ00383, anticorps H+-ATPase, anticorps ATPase H+ transporting accessory protein 1, anticorps ATPase, H+ transporting, lysosomal accessory protein 1, anticorps plasma membrane ATPase 4, anticorps ATP6AP1, anticorps Atp6ap1, anticorps LOC547525
- Sujet
- This gene encodes a component of a multisubunit enzyme (1 mDa MW) that mediates acidification of eukaryotic intracellular organelles. Vacuolar ATPase (V-ATPase) is comprised of a cytosolic V1 (site of the ATP catalytic site) and a transmembrane V0 domain. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, and receptor-mediated endocytosis. The encoded protein of this gene is approximately 45 kDa and may assist in the V-ATPase-mediated acidification of neuroendocrine secretory granules.
- Poids moléculaire
- 52 kDa (MW of target protein)
- Pathways
- Proton Transport, SARS-CoV-2 Protein Interactome
-