CFDP1 anticorps (Middle Region)
-
- Antigène Voir toutes CFDP1 Anticorps
- CFDP1 (Craniofacial Development Protein 1 (CFDP1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CFDP1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CFDP1 antibody was raised against the middle region of CFDP1
- Purification
- Affinity purified
- Immunogène
- CFDP1 antibody was raised using the middle region of CFDP1 corresponding to a region with amino acids GSGLKRSSGMSSLLGKIGAKKQKMSTLEKSKLDWESFKEEEGIGEELAIH
- Top Product
- Discover our top product CFDP1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CFDP1 Blocking Peptide, catalog no. 33R-3561, is also available for use as a blocking control in assays to test for specificity of this CFDP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CFDP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CFDP1 (Craniofacial Development Protein 1 (CFDP1))
- Autre désignation
- CFDP1 (CFDP1 Produits)
- Synonymes
- anticorps CFDP1, anticorps cfdp1, anticorps fi15f05, anticorps MGC136405, anticorps wu:fi15f05, anticorps zgc:136405, anticorps BCNT, anticorps BUCENTAUR, anticorps CENP-29, anticorps CP27, anticorps SWC5, anticorps Yeti, anticorps p97, anticorps AA408409, anticorps Bcnt, anticorps Bucentaur, anticorps Cfdp, anticorps cp27, anticorps bcnt, anticorps P97, anticorps craniofacial development protein 1, anticorps CFDP1, anticorps cfdp1, anticorps CpipJ_CPIJ018830, anticorps LOC100282347, anticorps Cfdp1
- Sujet
- CFDP1 may play a role during embryogenesis.
- Poids moléculaire
- 33 kDa (MW of target protein)
-