Glycerol Kinase anticorps (Middle Region)
-
- Antigène Voir toutes Glycerol Kinase (GK) Anticorps
- Glycerol Kinase (GK)
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Glycerol Kinase est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- GK antibody was raised against the middle region of GK
- Purification
- Affinity purified
- Immunogène
- GK antibody was raised using the middle region of GK corresponding to a region with amino acids MAAGAAEGVGVWSLEPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKS
- Top Product
- Discover our top product GK Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GK Blocking Peptide, catalog no. 33R-5595, is also available for use as a blocking control in assays to test for specificity of this GK antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GK antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Glycerol Kinase (GK)
- Autre désignation
- GK (GK Produits)
- Synonymes
- anticorps GK1, anticorps GKD, anticorps D930012N15Rik, anticorps GK, anticorps CG18374, anticorps Dmel\\CG18374, anticorps dGyk, anticorps ASTP, anticorps Gyk, anticorps gk1, anticorps gk2, anticorps gkd, anticorps gyk, anticorps Gk, anticorps BmGK, anticorps DKFZp469P1225, anticorps glycerol kinase, anticorps Glycerol kinase 1, anticorps glycerol kinase S homeolog, anticorps putative glycerol kinase 3, anticorps ATP:glycerol 3-phosphotransferase; glycerokinase; GK, anticorps Glycerol kinase, anticorps Fanconi anemia core complex associated protein 100, anticorps GK, anticorps Gk, anticorps Gk1, anticorps gk.S, anticorps LOC705001, anticorps glpK, anticorps Spico_1557, anticorps Trebr_0397, anticorps Halhy_5315, anticorps gk, anticorps FAAP100
- Sujet
- The product of this gene belongs to the FGGY kinase family of proteins and encodes glycerol kinase. Glycerol kinase is a key enzyme in the regulation of glycerol uptake and metabolism. It catalyzes the phosphorylation of glycerol by ATP, yielding ADP and glycerol-3-phosphate. Defects in this gene are the cause of glycerol kinase deficiency (GkDa). Alternatively spliced transcript variants encoding different isoforms have been identified.
- Poids moléculaire
- 58 kDa (MW of target protein)
-