AP1m2 anticorps (N-Term)

N° du produit ABIN633108

Détail du produit anti-AP1m2 anticorps

Antigène: AP1m2 (Adaptor-Related Protein Complex 1, mu 2 Subunit (AP1m2))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AP1m2 est non-conjugé

Application: Western Blotting (WB)

Specificité: AP1 M2 antibody was raised against the N terminal of AP1 2

Purification: Affinity purified

Immunogène: AP1 M2 antibody was raised using the N terminal of AP1 2 corresponding to a region with amino acids MSASAVFILDVKGKPLISRNYKGDVAMSKIEHFMPLLVQREEEGALAPLL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AP1M2 Blocking Peptide, catalog no. 33R-6400, is also available for use as a blocking control in assays to test for specificity of this AP1M2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AP0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AP1m2

Antigène: AP1m2 (Adaptor-Related Protein Complex 1, mu 2 Subunit (AP1m2))

Autre désignation: AP1M2 (AP1m2 Produits)

Synonymes: anticorps Ap1m1, anticorps zgc:103537, anticorps D9Ertd818e, anticorps [m]1B, anticorps mu1B, anticorps AP1-mu2, anticorps HSMU1B, anticorps MU-1B, anticorps MU1B, anticorps mu2, anticorps adaptor-related protein complex 1, mu 2 subunit, anticorps adaptor related protein complex 1 mu 2 subunit, anticorps adaptor protein complex AP-1, mu 2 subunit, anticorps ap1m2, anticorps AP1M2, anticorps Ap1m2

Sujet: This gene encodes a subunit of the heterotetrameric adaptor-related protein comlex 1 (AP-1), which belongs to the adaptor complexes medium subunits family. This protein is capable of interacting with tyrosine-based sorting signals.

Poids moléculaire: 48 kDa (MW of target protein)