ARHGEF19 anticorps

N° du produit ABIN633111

Détail du produit anti-ARHGEF19 anticorps

Antigène: ARHGEF19 (rho Guanine Nucleotide Exchange Factor (GEF) 19 (ARHGEF19))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ARHGEF19 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: ARHGEF19 antibody was raised using a synthetic peptide corresponding to a region with amino acids RFLLNSVLYQEYSDVASARELRRQQREEEGPGDEAEGAEEGPGPPRANLS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ARHGEF19 Blocking Peptide, catalog no. 33R-7904, is also available for use as a blocking control in assays to test for specificity of this ARHGEF19 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARHGEF19 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ARHGEF19

Antigène: ARHGEF19 (rho Guanine Nucleotide Exchange Factor (GEF) 19 (ARHGEF19))

Autre désignation: ARHGEF19 (ARHGEF19 Produits)

Synonymes: anticorps WGEF, anticorps 6030432F23, anticorps 6430573B13Rik, anticorps Rho guanine nucleotide exchange factor 19, anticorps Rho guanine nucleotide exchange factor (GEF) 19, anticorps ARHGEF19, anticorps Arhgef19

Sujet: Guanine nucleotide exchange factors (GEFs) such as ARHGEF19 accelerate the GTPase activity of Rho GTPases.

Poids moléculaire: 89 kDa (MW of target protein)