C19orf18 anticorps (N-Term)

N° du produit ABIN633114

Détail du produit anti-C19orf18 anticorps

Antigène: C19orf18 (Chromosome 19 Open Reading Frame 18 (C19orf18))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C19orf18 est non-conjugé

Application: Western Blotting (WB)

Specificité: C19 orf18 antibody was raised against the N terminal of C19 rf18

Purification: Affinity purified

Immunogène: C19 orf18 antibody was raised using the N terminal of C19 rf18 corresponding to a region with amino acids NITGLPGSKRSQPPRNITKEPKVFFHKTQLPGIQGAASRSTAASPTNPMK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C19orf18 Blocking Peptide, catalog no. 33R-6735, is also available for use as a blocking control in assays to test for specificity of this C19orf18 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 rf18 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C19orf18

Antigène: C19orf18 (Chromosome 19 Open Reading Frame 18 (C19orf18))

Autre désignation: C19orf18 (C19orf18 Produits)

Synonymes: anticorps chromosome 19 open reading frame 18, anticorps C19orf18

Sujet: The function of Chromosome 19 ORF protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 24 kDa (MW of target protein)