RFTN2 anticorps (N-Term)

N° du produit ABIN633116

Détail du produit anti-RFTN2 anticorps

Antigène: RFTN2 (Raftlin Family Member 2 (RFTN2))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RFTN2 est non-conjugé

Application: Western Blotting (WB)

Specificité: RFTN2 antibody was raised against the N terminal of RFTN2

Purification: Affinity purified

Immunogène: RFTN2 antibody was raised using the N terminal of RFTN2 corresponding to a region with amino acids MGCGLRKLEDPDDSSPGKIFSTLKRPQVETKTEFAYEYVLLDFTLQASSN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RFTN2 Blocking Peptide, catalog no. 33R-6014, is also available for use as a blocking control in assays to test for specificity of this RFTN2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RFTN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RFTN2

Antigène: RFTN2 (Raftlin Family Member 2 (RFTN2))

Autre désignation: RFTN2 (RFTN2 Produits)

Synonymes: anticorps RGD1307304, anticorps zgc:56544, anticorps wu:fi98e03, anticorps Raftlin-2, anticorps DKFZp459I212, anticorps C2orf11, anticorps 2700010E02Rik, anticorps 3222401M22Rik, anticorps raftlin family member 2, anticorps Rftn2, anticorps RFTN2, anticorps rftn2

Sujet: The function of the protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 56 kDa (MW of target protein)