EFCAB3 anticorps (N-Term)
-
- Antigène Tous les produits EFCAB3
- EFCAB3 (EF-Hand Calcium Binding Domain 3 (EFCAB3))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp EFCAB3 est non-conjugé
- Application
- Western Blotting (WB)
- Specificité
- EFCAB3 antibody was raised against the N terminal of EFCAB3
- Purification
- Affinity purified
- Immunogène
- EFCAB3 antibody was raised using the N terminal of EFCAB3 corresponding to a region with amino acids MAVSEIKPKLKLNPLTKVPISHNKRDRDLPGSLQCQLQHKEKKLSASQMA
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
EFCAB3 Blocking Peptide, catalog no. 33R-5801, is also available for use as a blocking control in assays to test for specificity of this EFCAB3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EFCAB3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- EFCAB3 (EF-Hand Calcium Binding Domain 3 (EFCAB3))
- Autre désignation
- EFCAB3 (EFCAB3 Produits)
- Synonymes
- anticorps 4921510J17Rik, anticorps RGD1305423, anticorps EF-hand calcium binding domain 3, anticorps EFCAB3, anticorps Efcab3
- Sujet
- The function of the protein has not been widely studied, and is yet to be fully elucidated.
- Poids moléculaire
- 50 kDa (MW of target protein)
-