GLIPR1L1 anticorps (Middle Region)

N° du produit ABIN633140

Détail du produit anti-GLIPR1L1 anticorps

Antigène: GLIPR1L1 (GLI Pathogenesis-Related 1 Like 1 (GLIPR1L1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GLIPR1L1 est non-conjugé

Application: Western Blotting (WB)

Specificité: GLIPR1 L1 antibody was raised against the middle region of GLIPR1 1

Purification: Affinity purified

Immunogène: GLIPR1 L1 antibody was raised using the middle region of GLIPR1 1 corresponding to a region with amino acids NMPPYVRGESCSLCSKEEKCVKNLCKNPFLKPTGRAPQQTAFNPFSLGFL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GLIPR1L1 Blocking Peptide, catalog no. 33R-6798, is also available for use as a blocking control in assays to test for specificity of this GLIPR1L1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLIPR0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GLIPR1L1

Antigène: GLIPR1L1 (GLI Pathogenesis-Related 1 Like 1 (GLIPR1L1))

Autre désignation: GLIPR1L1 (GLIPR1L1 Produits)

Synonymes: anticorps 1700011E04Rik, anticorps ALKN2972, anticorps PRO7434, anticorps GLI pathogenesis-related 1 like 1, anticorps GLI pathogenesis related 1 like 1, anticorps Glipr1l1, anticorps GLIPR1L1

Sujet: GLIPR1L1 is a novel testis-specific CAP protein and is presented to the acrosomal cap following in vitro capacitation.

Poids moléculaire: 26 kDa (MW of target protein)