CRNN anticorps (Middle Region)
-
- Antigène Voir toutes CRNN Anticorps
- CRNN (Cornulin (CRNN))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CRNN est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Cornulin antibody was raised against the middle region of CRNN
- Purification
- Affinity purified
- Immunogène
- Cornulin antibody was raised using the middle region of CRNN corresponding to a region with amino acids GDRQPTVVGEEWVDDHSRETVILRLDQGNLHTSVSSAQGQDAAQSEEKRG
- Top Product
- Discover our top product CRNN Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Cornulin Blocking Peptide, catalog no. 33R-3210, is also available for use as a blocking control in assays to test for specificity of this Cornulin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRNN antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CRNN (Cornulin (CRNN))
- Autre désignation
- Cornulin (CRNN Produits)
- Synonymes
- anticorps C1orf10, anticorps DRC1, anticorps PDRC1, anticorps SEP53, anticorps RGD1311778, anticorps Gm1015, anticorps cornulin, anticorps CRNN, anticorps Crnn, anticorps LOC100359146
- Sujet
- This gene encodes a member of the 'fused gene' family of proteins, which contain N-terminus EF-hand domains and multiple tandem peptide repeats. The encoded protein contains two EF-hand Ca2+ binding domains in its N-terminus and two glutamine- and threonine-rich 60 amino acid repeats in its C-terminus. This gene, also known as squamous epithelial heat shock protein 53, may play a role in the mucosal/epithelial immune response and epidermal differentiation.
- Poids moléculaire
- 52 kDa (MW of target protein)
-