PAGE4 anticorps
-
- Antigène Voir toutes PAGE4 Anticorps
- PAGE4 (P Antigen Family, Member 4 (Prostate Associated) (PAGE4))
- Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PAGE4 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- PAGE4 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPIEERKVEGDCQEMDLEKTRSERGDGSDVKEKTPPNPKHAKTKEAGDGQ
- Top Product
- Discover our top product PAGE4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PAGE4 Blocking Peptide, catalog no. 33R-7259, is also available for use as a blocking control in assays to test for specificity of this PAGE4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAGE4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PAGE4 (P Antigen Family, Member 4 (Prostate Associated) (PAGE4))
- Autre désignation
- PAGE4 (PAGE4 Produits)
- Sujet
- This gene is a member of the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is strongly expressed in prostate and prostate cancer, but is also expressed in other male and female reproductive tissues including testis, fallopian tube, uterus, and placenta, as well as in testicular cancer and uterine cancer. The protein encoded by this gene shares sequence similarity with other GAGE/PAGE proteins, and also belongs to a family of CT (cancer-testis) antigens.
- Poids moléculaire
- 11 kDa (MW of target protein)
-