OST alpha anticorps (Middle Region)

N° du produit ABIN633166

Détail du produit anti-OST alpha anticorps

Antigène: OST alpha (OSTALPHA) (Organic Solute Transporter alpha (OSTALPHA))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp OST alpha est non-conjugé

Application: Western Blotting (WB)

Specificité: OSTalpha antibody was raised against the middle region of OSTalpha

Purification: Affinity purified

Immunogène: OSTalpha antibody was raised using the middle region of OSTalpha corresponding to a region with amino acids LLMLGPFQYAFLKITLTLVGLFLVPDGIYDPADISEGSTALWINTFLGVS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

OSTalpha Blocking Peptide, catalog no. 33R-5169, is also available for use as a blocking control in assays to test for specificity of this OSTalpha antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OSTalpha antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur OST alpha

Antigène: OST alpha (OSTALPHA) (Organic Solute Transporter alpha (OSTALPHA))

Autre désignation: OSTalpha (OSTALPHA Produits)

Synonymes: anticorps Osta, anticorps Ostalpha, anticorps RGD1311100, anticorps OSTA, anticorps OSTalpha, anticorps AV001382, anticorps AW261577, anticorps D630035O19Rik, anticorps OSTALPHA, anticorps solute carrier family 51, alpha subunit, anticorps solute carrier family 51 alpha subunit, anticorps Slc51a, anticorps SLC51A

Sujet: OSTalpha is essential component of the Ost-alpha/Ost-beta complex, a heterodimer that acts as the intestinal basolateral transporter responsible for bile acid export from enterocytes into portal blood. OSTalpha efficiently transports the major species of bile acids.

Poids moléculaire: 38 kDa (MW of target protein)