DOK6 anticorps (Middle Region)
-
- Antigène Voir toutes DOK6 Anticorps
- DOK6 (Docking Protein 6 (DOK6))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DOK6 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- DOK6 antibody was raised against the middle region of DOK6
- Purification
- Affinity purified
- Immunogène
- DOK6 antibody was raised using the middle region of DOK6 corresponding to a region with amino acids IYSLQGHGFGSSKMSRAQTFPSYAPEQSEEAQQPLSRSSSYGFSYSSSLI
- Top Product
- Discover our top product DOK6 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DOK6 Blocking Peptide, catalog no. 33R-4227, is also available for use as a blocking control in assays to test for specificity of this DOK6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DOK6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DOK6 (Docking Protein 6 (DOK6))
- Autre désignation
- DOK6 (DOK6 Produits)
- Synonymes
- anticorps DOK5L, anticorps HsT3226, anticorps Dok-6, anticorps RGD1564376, anticorps docking protein 6, anticorps DOK6, anticorps Dok6
- Sujet
- DOK6 is a member of the DOK family of intracellular adaptors that play a role in the RET signaling cascade.
- Poids moléculaire
- 38 kDa (MW of target protein)
-