MBL2 anticorps (Middle Region)
-
- Antigène Voir toutes MBL2 Anticorps
- MBL2 (Mannose-Binding Lectin (Protein C) 2, Soluble (MBL2))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MBL2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- MBL2 antibody was raised against the middle region of MBL2
- Purification
- Affinity purified
- Immunogène
- MBL2 antibody was raised using the middle region of MBL2 corresponding to a region with amino acids KEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKN
- Top Product
- Discover our top product MBL2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MBL2 Blocking Peptide, catalog no. 33R-4323, is also available for use as a blocking control in assays to test for specificity of this MBL2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MBL2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MBL2 (Mannose-Binding Lectin (Protein C) 2, Soluble (MBL2))
- Autre désignation
- MBL2 (MBL2 Produits)
- Synonymes
- anticorps COLEC1, anticorps HSMBPC, anticorps MBL, anticorps MBL2D, anticorps MBP, anticorps MBP-C, anticorps MBP1, anticorps MBPD, anticorps pMBP-27, anticorps mbl2, anticorps MBL1, anticorps cMBl, anticorps collectin, anticorps Ab2-001, anticorps Ab2-011, anticorps L-MBP, anticorps MBL-C, anticorps COLEC2, anticorps mbl, anticorps etID42583.2, anticorps fb68b07, anticorps hbl3, anticorps wu:fb68b07, anticorps zgc:109836, anticorps mannose binding lectin 2, anticorps Mannose-binding protein C, anticorps mannose-binding lectin (protein C) 2, soluble, anticorps mannose-binding lectin (protein C) 2, anticorps mannose-binding lectin family member 3, pseudogene, anticorps MBL2, anticorps mbl2, anticorps Mbl2, anticorps MBL3P
- Sujet
- This gene encodes the soluble mannose-binding lectin or mannose-binding protein found in serum. The protein encoded belongs to the collectin family and is an important element in the innate immune system. The protein recognises mannose and N-acetylglucosamine on many microorganisms, and is capable of activating the classical complement pathway. Deficiencies of this gene have been associated with susceptibility to autoimmune and infectious diseases.
- Poids moléculaire
- 24 kDa (MW of target protein)
- Pathways
- Système du Complément, Positive Regulation of Immune Effector Process
-