NAA15 anticorps (N-Term)

N° du produit ABIN633172

Détail du produit anti-NAA15 anticorps

Antigène: NAA15 (N(alpha)-Acetyltransferase 15, NatA Auxiliary Subunit (NAA15))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NAA15 est non-conjugé

Application: Western Blotting (WB)

Specificité: NARG1 antibody was raised against the N terminal of NARG1

Purification: Affinity purified

Immunogène: NARG1 antibody was raised using the N terminal of NARG1 corresponding to a region with amino acids LRPAQRASWIGYAIAYHLLEDYEMAAKILEEFRKTQQTSPDKVDYEYSEL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NARG1 Blocking Peptide, catalog no. 33R-5374, is also available for use as a blocking control in assays to test for specificity of this NARG1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NARG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NAA15

Antigène: NAA15 (N(alpha)-Acetyltransferase 15, NatA Auxiliary Subunit (NAA15))

Autre désignation: NARG1 (NAA15 Produits)

Synonymes: anticorps Ga19, anticorps NARG1, anticorps NATH, anticorps TBDN100, anticorps 5730450D16Rik, anticorps 6330400I15, anticorps ASTBDN, anticorps Narg1, anticorps Tbdn-1, anticorps mNAT1, anticorps narg1l, anticorps N(alpha)-acetyltransferase 15, NatA auxiliary subunit, anticorps N(alpha)-acetyltransferase 15, NatA auxiliary subunit S homeolog, anticorps NAA15, anticorps Naa15, anticorps naa15.S

Sujet: The ARD1A-NARG1 complex displays alpha (N-terminal) acetyltransferase activity that may be important for vascular, hematopoietic and neuronal growth and development. NARG1 is required to control retinal neovascularization in adult ocular endothelial cells. In complex with G22P1 and XRCC5 (Ku80), up-regulates transcription from the osteocalcin promoter.

Poids moléculaire: 101 kDa (MW of target protein)