FGF2 anticorps
-
- Antigène Voir toutes FGF2 Anticorps
- FGF2 (Fibroblast Growth Factor 2 (Basic) (FGF2))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FGF2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- FGF2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
- Top Product
- Discover our top product FGF2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
FGF2 Blocking Peptide, catalog no. 33R-8018, is also available for use as a blocking control in assays to test for specificity of this FGF2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FGF2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- FGF2 (Fibroblast Growth Factor 2 (Basic) (FGF2))
- Autre désignation
- FGF2 (FGF2 Produits)
- Synonymes
- anticorps BFGF, anticorps FGF-2, anticorps FGFB, anticorps HBGF-2, anticorps Fgf-2, anticorps Fgfb, anticorps bFGF, anticorps fibroblast growth factor 2, anticorps fibroblast growth factor 2 (basic), anticorps FGF2, anticorps Fgf2, anticorps fgf2
- Sujet
- The heparin-binding growth factors are angiogenic agents in vivo and are potent mitogens for a variety of cell types in vitro. There are differences in the tissue distribution and concentration of these 2 growth factors.
- Poids moléculaire
- 31 kDa (MW of target protein)
- Pathways
- Signalisation RTK, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, C21-Steroid Hormone Metabolic Process, Inositol Metabolic Process, Glycosaminoglycan Metabolic Process, Protein targeting to Nucleus, S100 Proteins
-