TMPRSS6 anticorps (N-Term)
-
- Antigène Voir toutes TMPRSS6 Anticorps
- TMPRSS6 (Transmembrane Protease, serine 6 (TMPRSS6))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TMPRSS6 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TMPRSS6 antibody was raised against the N terminal of TMPRSS6
- Purification
- Affinity purified
- Immunogène
- TMPRSS6 antibody was raised using the N terminal of TMPRSS6 corresponding to a region with amino acids LLWYFLGYKAEVMVSQVYSGSLRVLNRHFSQDLTRRESSAFRSETAKAQK
- Top Product
- Discover our top product TMPRSS6 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TMPRSS6 Blocking Peptide, catalog no. 33R-5200, is also available for use as a blocking control in assays to test for specificity of this TMPRSS6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMPRSS6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TMPRSS6 (Transmembrane Protease, serine 6 (TMPRSS6))
- Autre désignation
- TMPRSS6 (TMPRSS6 Produits)
- Synonymes
- anticorps IRIDA, anticorps 1300008A22Rik, anticorps transmembrane protease, serine 6, anticorps transmembrane serine protease 6, anticorps Tmprss6, anticorps TMPRSS6
- Sujet
- TMPRSS6 is a serine protease which hydrolyzes a range of proteins including type I collagen, fibronectin and fibrinogen. TMPRSS6 can also activate urokinase-type plasminogen activator with low efficiency. TMPRSS6 may play a specialized role in matrix remodeling processes in liver. TMPRSS6 is required to sense iron deficiency. Overexpression of TMPRSS6 suppresses activation of the HAMP promoter.
- Poids moléculaire
- 90 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis
-