PLXDC1 anticorps (N-Term)
-
- Antigène Voir toutes PLXDC1 Anticorps
- PLXDC1 (Plexin Domain Containing 1 (PLXDC1))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PLXDC1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PLXDC1 antibody was raised against the N terminal of PLXDC1
- Purification
- Affinity purified
- Immunogène
- PLXDC1 antibody was raised using the N terminal of PLXDC1 corresponding to a region with amino acids MDTLPDNRTRVVEDNHSYYVSRLYGPSEPHSRELWVDVAEANRSQVKIHT
- Top Product
- Discover our top product PLXDC1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PLXDC1 Blocking Peptide, catalog no. 33R-5878, is also available for use as a blocking control in assays to test for specificity of this PLXDC1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLXDC1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PLXDC1 (Plexin Domain Containing 1 (PLXDC1))
- Autre désignation
- PLXDC1 (PLXDC1 Produits)
- Synonymes
- anticorps PLXDC1, anticorps TEM3, anticorps TEM7, anticorps 2410003I07Rik, anticorps AI848450, anticorps Tem7, anticorps Arl12, anticorps plexin domain containing 1, anticorps PLXDC1, anticorps Plxdc1
- Sujet
- PLXDC1 (TEM7) may play significant role in proliferation and maintenance of neovascular endothelial cells in fibrovascular membranes. TEM7 may be molecular target for new diagnostic and therapeutic strategies for proliferative diabetic retinopathy. The expression level of TEM7 closely parallels histology-based prognostication of osteogenic sarcoma metastasis and, therefore, it is a therapeutic target.
- Poids moléculaire
- 54 kDa (MW of target protein)
-