PURB anticorps (N-Term)

N° du produit ABIN633184

Détail du produit anti-PURB anticorps

Antigène: PURB (Purine-Rich Element Binding Protein B (PURB))

Épitope: N-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PURB est non-conjugé

Application: Western Blotting (WB)

Specificité: PURB antibody was raised against the N terminal of PURB

Purification: Affinity purified

Immunogène: PURB antibody was raised using the N terminal of PURB corresponding to a region with amino acids MADGDSGSERGGGGGPCGFQPASRGGGEQETQELASKRLDIQNKRFYLDV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PURB Blocking Peptide, catalog no. 33R-5621, is also available for use as a blocking control in assays to test for specificity of this PURB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PURB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PURB

Antigène: PURB (Purine-Rich Element Binding Protein B (PURB))

Autre désignation: PURB (PURB Produits)

Synonymes: anticorps 2310015K15Rik, anticorps AA114818, anticorps Cager-2, anticorps D11Bwg0414e, anticorps pur-beta, anticorps purb, anticorps zgc:65916, anticorps purb-b, anticorps purbeta, anticorps PURBETA, anticorps si:dkey-202n14.1, anticorps purine rich element binding protein B, anticorps purine-rich element binding protein Bb, anticorps purine-rich element binding protein B L homeolog, anticorps purine-rich element binding protein Ba, anticorps Purb, anticorps purbb, anticorps purb.L, anticorps PURB, anticorps purba

Sujet: This gene product is a sequence-specific, single-stranded DNA-binding protein.

Poids moléculaire: 33 kDa (MW of target protein)