RECQL5 anticorps (Middle Region)
-
- Antigène Voir toutes RECQL5 Anticorps
- RECQL5 (RecQ Protein-Like 5 (RECQL5))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RECQL5 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RecQL5 antibody was raised against the middle region of RECQL5
- Purification
- Affinity purified
- Immunogène
- RecQL5 antibody was raised using the middle region of RECQL5 corresponding to a region with amino acids CDHCQNPTAVRRRLEALERSSSWSKTCIGPSQGNGFDPELYEGGRKGYGD
- Top Product
- Discover our top product RECQL5 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RecQL5 Blocking Peptide, catalog no. 33R-1661, is also available for use as a blocking control in assays to test for specificity of this RecQL5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RECQL5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RECQL5 (RecQ Protein-Like 5 (RECQL5))
- Autre désignation
- RecQL5 (RECQL5 Produits)
- Synonymes
- anticorps RecQ5, anticorps DKFZp459N0627, anticorps recq5, anticorps RECQ5, anticorps Recq5b, anticorps Recql5b, anticorps RecQ like helicase 5, anticorps RecQ helicase-like 5, anticorps ATP-dependent DNA helicase Q5, anticorps RecQ protein-like 5, anticorps RECQL5, anticorps recql5, anticorps LOC100544199, anticorps Recql5
- Sujet
- RECQL5 may have an important role in DNA metabolism.
- Poids moléculaire
- 109 kDa (MW of target protein)
-